Projects

Projects Online

Below are images of the home pages for websites that have been put on-line with their own domain names. Most of these projects are near completion or require updates from time to time. The images link to the home pages of their respective websites.

moniquelanglcsw.commoniquelanglcsw.comtraumastudiescenter.orgtraumastudiescenter.orglesbiantherapist.comlesbiantherapist.combettegalenlcsw.combettegalenlcsw.comqualitypestcontrolco.comqualitypestcontrolco.comunitedparishbrookline.orgunitedparishbrookline.org

Projects In Development

The images below are the home pages of websites that are in early stages of development. As such they use subdomains for client access on the web. While the home pages are visible to the public, most of the internal pages have access restricted to the client and those designated by the client for viewing.

newavalanchenewavalancheyesimascrapaholicyesimascrapaholicmainlinenorthmainlinenorth Integrity FirstIntegrity FirstMy Smiling DentistMy Smiling Dentist